Structure of PDB 3oxk Chain A

Receptor sequence
>3oxkA (length=115) Species: 294381 (Entamoeba histolytica HM-1:IMSS) [Search protein sequence]
GSMADSCIFCKIAQKQIPSTIVYEDDEIFAFKDINPIAPIHILVIPKQHI
ASLNEITEENEAFIGKVLYKVSLIGKKECPEGYRVVNNIGEDAGQTVKHI
HFHILGGKKLAWDKL
3D structure
PDB3oxk Structures of a histidine triad family protein from Entamoeba histolytica bound to sulfate, AMP and GMP.
ChainA
Resolution1.55 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N86 H97 H99 H101
Catalytic site (residue number reindexed from 1) N88 H99 H101 H103
Enzyme Commision number 3.9.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C5 C8 H47 H97 C7 C10 H49 H99
BS02 5GP A F29 D31 I32 L41 N86 Q93 T94 H99 H101 F31 D33 I34 L43 N88 Q95 T96 H101 H103
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0016787 hydrolase activity
GO:0043530 adenosine 5'-monophosphoramidase activity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3oxk, PDBe:3oxk, PDBj:3oxk
PDBsum3oxk
PubMed25945711
UniProtC4LYI2|HIT_ENTH1 Histidine triad nucleotide-binding protein (Gene Name=EHI_093910)

[Back to BioLiP]