Structure of PDB 3ova Chain A

Receptor sequence

>3ovaA (length=430) Species: 2234 (Archaeoglobus fulgidus)

VEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNT
WLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHG
VVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLK
GFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVID
VAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLG
FFKPIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEF
LERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKK
FLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGES
IREYFEIISGEKLFKEPVTAELCEMMGVKD

3D structure

• PDB: 3ova How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.
• Chain: A
• Resolution: 1.98 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.72: CCA tRNA nucleotidyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	D61 F63 A95 E96 H97 Y99 D110 V127 T130 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 K303 R310 R344 M345 G346 P347 N354 K357 F358 R361 Y392 H396 H398 T399 G401 K402	D59 F61 A93 E94 H95 Y97 D108 V125 T128 A161 E162 Y163 R222 A226 N227 D284 N285 P288 Q289 K296 R303 R337 M338 G339 P340 N347 K350 F351 R354 Y385 H389 H391 T392 G394 K395
BS02	APC	A	G46 S47 D61 T130 H133 K152 Y161 R224	G44 S45 D59 T128 H131 K150 Y159 R222
BS03	MG	A	E59 D61	E57 D59

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001680 tRNA 3'-terminal CCA addition
• GO:0008033 tRNA processing
• GO:0031123 RNA 3'-end processing
• GO:0042245 RNA repair

External links

• PDB: RCSB:3ova, PDBe:3ova, PDBj:3ova
• PDBsum: 3ova
• PubMed: 21071662
• UniProt: A0A101DCH0