Structure of PDB 3ouy Chain A

Receptor sequence

>3ouyA (length=441) Species: 2234 (Archaeoglobus fulgidus)

MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYAR
NTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYV
HGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRL
LKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTV
IDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPS
LGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERA
SRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFE
DERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDCCCM

3D structure

• PDB: 3ouy How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.
• Chain: A
• Resolution: 2.69 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.72: CCA tRNA nucleotidyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	D61 F63 A95 E96 Y99 D110 V112 V127 T130 H133 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 K303 R310 P347 N354 F358 Y392 H396 H398 T399 K402	D61 F63 A95 E96 Y99 D110 V112 V127 T130 H133 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 K303 R310 P347 N354 F358 Y392 H396 H398 T399 K402
BS02	POP	A	G46 S47 K152 Y161	G46 S47 K152 Y161

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0160016 CCACCA tRNA nucleotidyltransferase activity

Biological Process

• GO:0001680 tRNA 3'-terminal CCA addition
• GO:0008033 tRNA processing
• GO:0031123 RNA 3'-end processing
• GO:0042245 RNA repair
• GO:0106354 tRNA surveillance

External links

• PDB: RCSB:3ouy, PDBe:3ouy, PDBj:3ouy
• PDBsum: 3ouy
• PubMed: 21071662
• UniProt: O28126|CCA_ARCFU CCA-adding enzyme (Gene Name=cca)