Structure of PDB 3otb Chain A

Receptor sequence

>3otbA (length=237) Species: 9606 (Homo sapiens)

SKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQL
MTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQ
FASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHI
NNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNEL
PMYRKGTVLIWQTKPVPLHCDIIGDAFWKEHPEILDE

3D structure

• PDB: 3otb tRNAHis guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases.
• Chain: A
• Resolution: 2.95 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.79: tRNA(His) guanylyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DGT	A	D29 G30 R31 N32 F33 H34 F42 S75 D76	D26 G27 R28 N29 F30 H31 F39 S72 D73
BS02	MG	A	D29 G30 D76	D26 G27 D73
BS03	MG	A	D29 D76	D26 D73
BS04	3PO	A	R92 K95	R89 K92

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0005085 guanyl-nucleotide exchange factor activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0005525 GTP binding
• GO:0008193 tRNA guanylyltransferase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006400 tRNA modification
• GO:0006979 response to oxidative stress
• GO:0008033 tRNA processing
• GO:0008053 mitochondrial fusion
• GO:0051289 protein homotetramerization
• GO:0099116 tRNA 5'-end processing
• GO:1990046 stress-induced mitochondrial fusion

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005741 mitochondrial outer membrane
• GO:0005829 cytosol
• GO:1990234 transferase complex

External links

• PDB: RCSB:3otb, PDBe:3otb, PDBj:3otb
• PDBsum: 3otb
• PubMed: 21059936
• UniProt: Q9NWX6|THG1_HUMAN Probable tRNA(His) guanylyltransferase (Gene Name=THG1L)