Structure of PDB 3osg Chain A

Receptor sequence
>3osgA (length=110) Species: 5722 (Trichomonas vaginalis) [Search protein sequence]
VQVNKAAKKQKFTPEEDEMLKRAVAQHGSDWKMIAATFPNRNARQCRDRW
KNYLAPSISHTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNR
WVTISNKLGI
3D structure
PDB3osg Molecular basis of the recognition of the ap65-1 gene transcription promoter elements by a Myb protein from the protozoan parasite Trichomonas vaginalis.
ChainA
Resolution1.997 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K49 Q50 K51 R84 Q85 R89 Y93 N139 V142 T143 N146 K9 Q10 K11 R44 Q45 R49 Y53 N99 V102 T103 N106 PDBbind-CN: Kd=110nM
BS02 dna A A47 K48 K49 R87 R120 W122 A123 K138 A7 K8 K9 R47 R80 W82 A83 K98 PDBbind-CN: Kd=110nM
External links