Structure of PDB 3or1 Chain A

Receptor sequence

>3or1A (length=435) Species: 879 (Megalodesulfovibrio gigas)

KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLG
ILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRL
AQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEI
FFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQ
DELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVK
AYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKN
CTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAE
EPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQ
HVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR

3D structure

• PDB: 3or1 Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
• Chain: A
• Resolution: 1.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO3	A	R172 K213 K215	R170 K211 K213
BS02	SRM	A	R83 R101 G134 S135 T136 D138 Y212 K213 K215 K217 R231 K332 A333 V335 R378	R81 R99 G132 S133 T134 D136 Y210 K211 K213 K215 R229 K330 A331 V333 R376
BS03	SF4	A	C284 P285 C288 M289 C303 T304 R305 C306 M307 H308 C309	C282 P283 C286 M287 C301 T302 R303 C304 M305 H306 C307
BS04	SF4	A	C177 L178 C183 F185 A186 G220 C221 C225	C175 L176 C181 F183 A184 G218 C219 C223
BS05	SRM	A	C177 L178 C183 E184 F185 N223 C225 N262 N311	C175 L176 C181 E182 F183 N221 C223 N260 N309

Gene Ontology

Molecular Function

• GO:0016002 sulfite reductase activity
• GO:0016491 oxidoreductase activity
• GO:0018551 dissimilatory sulfite reductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0050311 sulfite reductase (ferredoxin) activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0000103 sulfate assimilation

Cellular Component

• GO:0009337 sulfite reductase complex (NADPH)

External links

• PDB: RCSB:3or1, PDBe:3or1, PDBj:3or1
• PDBsum: 3or1
• UniProt: E2QR97