Structure of PDB 3op4 Chain A

Receptor sequence
>3op4A (length=247) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) [Search protein sequence]
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISD
YLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMR
MKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAG
QANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQR
TATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
3D structure
PDB3op4 Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP A G16 S18 R19 I21 T41 N63 V64 N90 A91 I93 V140 S142 Y155 K159 P185 G186 I188 T190 M192 G15 S17 R18 I20 T40 N62 V63 N89 A90 I92 V139 S141 Y154 K158 P184 G185 I187 T189 M191
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 09:58:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3op4', asym_id = 'A', title = 'Dissecting the Structural Elements for the Activ... Carrier Protein) Reductase from Vibrio cholerae.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3op4', asym_id='A', title='Dissecting the Structural Elements for the Activ... Carrier Protein) Reductase from Vibrio cholerae.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004316,0006633,0016491,0051287', uniprot = '', pdbid = '3op4', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004316,0006633,0016491,0051287', uniprot='', pdbid='3op4', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>