Structure of PDB 3oo1 Chain A

Receptor sequence
>3oo1A (length=128) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY
GFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQA
GASGYVVKPFTPATLEEKLNKIFEKLGM
3D structure
PDB3oo1 Exploring the effect of an allosteric site on conformational coupling in CheY
ChainA
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A D13 D57 N59 D12 D56 N58
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000287 magnesium ion binding
GO:0005515 protein binding
GO:0016407 acetyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006935 chemotaxis
GO:0007165 signal transduction
GO:0009454 aerotaxis
GO:0018393 internal peptidyl-lysine acetylation
GO:0043052 thermotaxis
GO:0050920 regulation of chemotaxis
GO:0071977 bacterial-type flagellum-dependent swimming motility
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
GO:1902021 regulation of bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009288 bacterial-type flagellum
GO:0009433 bacterial-type flagellum basal body, C ring
GO:0120107 bacterial-type flagellum rotor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3oo1, PDBe:3oo1, PDBj:3oo1
PDBsum3oo1
PubMed
UniProtP0AE67|CHEY_ECOLI Chemotaxis protein CheY (Gene Name=cheY)

[Back to BioLiP]