Structure of PDB 3omf Chain A

Receptor sequence
>3omfA (length=111) Species: 294381 (Entamoeba histolytica HM-1:IMSS) [Search protein sequence]
DSCIFCKIAQKQIPSTIVYEDDEIFAFKDINPIAPIHILVIPKQHIASLN
EITEENEAFIGKVLYKVSLIGKKECPEGYRVVNNIGEDAGQTVKHIHFHI
LGGKKLAWDKL
3D structure
PDB3omf Structures of a histidine triad family protein from Entamoeba histolytica bound to sulfate, AMP and GMP.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N86 H97 H99 H101
Catalytic site (residue number reindexed from 1) N84 H95 H97 H99
Enzyme Commision number 3.9.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C5 C8 H47 H97 C3 C6 H45 H95
BS02 AMP A F29 D31 I32 L41 N86 Q93 T94 H99 H101 F27 D29 I30 L39 N84 Q91 T92 H97 H99
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0016787 hydrolase activity
GO:0043530 adenosine 5'-monophosphoramidase activity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3omf, PDBe:3omf, PDBj:3omf
PDBsum3omf
PubMed25945711
UniProtC4LYI2|HIT_ENTH1 Histidine triad nucleotide-binding protein (Gene Name=EHI_093910)

[Back to BioLiP]