Structure of PDB 3oes Chain A

Receptor sequence
>3oesA (length=157) Species: 9606 (Homo sapiens) [Search protein sequence]
RYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTEFHLHL
VDTAGQDEYSILPYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHERVP
VVLVGNKADLSPEREVQAVEGKKLAESWGATFMESSARENQLTQGIFTKV
IQEIARV
3D structure
PDB3oes Crystal structure of the small GTPase RhebL1
ChainA
Resolution2.301 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A T20 T38 T16 T34
BS02 GNP A R15 C16 G18 K19 T20 S21 F31 G34 Y35 T38 G63 N119 K120 D122 L123 S149 A150 R151 R11 C12 G14 K15 T16 S17 F27 G30 Y31 T34 G55 N106 K107 D109 L110 S136 A137 R138
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0031929 TOR signaling
GO:0051092 positive regulation of NF-kappaB transcription factor activity
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3oes, PDBe:3oes, PDBj:3oes
PDBsum3oes
PubMed
UniProtQ8TAI7|REBL1_HUMAN GTPase RhebL1 (Gene Name=RHEBL1)

[Back to BioLiP]