Structure of PDB 3o9x Chain A

Receptor sequence
>3o9xA (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEE
SDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAF
SRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
3D structure
PDB3o9x Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
ChainA
Resolution2.0999 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F22 R23 G93 G94 N97 R101 Y102 A107 Q108 F23 R24 G94 G95 N98 R102 Y103 A108 Q109 PDBbind-CN: Kd=0.8nM
BS02 dna A T84 Q85 N97 S100 H110 T85 Q86 N98 S101 H111 PDBbind-CN: Kd=0.8nM
BS03 ZN A C3 C6 C37 C40 C4 C7 C38 C41
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0044010 single-species biofilm formation
Cellular Component
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3o9x, PDBe:3o9x, PDBj:3o9x
PDBsum3o9x
PubMed21068382
UniProtQ46864|MQSA_ECOLI Antitoxin MqsA (Gene Name=mqsA)

[Back to BioLiP]