Structure of PDB 3o5c Chain A

Receptor sequence

>3o5cA (length=308) Species: 70863 (Shewanella oneidensis)

EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDA
LPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKE
MGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTP
NSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGL
IKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLE
EAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETP
RPVPFATG

3D structure

• PDB: 3o5c Investigation of the Electron Transport Chain to and the Catalytic Activity of the Diheme Cytochrome c Peroxidase CcpA of Shewanella oneidensis.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E123
• Catalytic site (residue number reindexed from 1): E100
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	C60 C63 H64 S77 I87 S89 P90 Q101 F102 W103 R106 Q113 P117 E123 M124 E167 K250	C37 C40 H41 S54 I64 S66 P67 Q78 F79 W80 R83 Q90 P94 E100 M101 E144 K227
BS02	HEM	A	W103 C204 C207 H208 M219 M221 F249 V251 P252 L254 I257 Y263 F264 H265 M279 A280 Q283	W80 C181 C184 H185 M196 M198 F226 V228 P229 L231 I234 Y240 F241 H242 M256 A257 Q260
BS03	CA	A	N88 T260 P262	N65 T237 P239

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0004601 peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3o5c, PDBe:3o5c, PDBj:3o5c
• PDBsum: 3o5c
• PubMed: 21742904
• UniProt: Q8EF24