Structure of PDB 3o03 Chain A

Receptor sequence
>3o03A (length=254) Species: 391295 (Streptococcus suis 05ZYH33) [Search protein sequence]
QFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDR
GMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIR
RVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMS
ELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTHP
FDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYI
GKQP
3D structure
PDB3o03 Structural Insight Into the Catalytic Mechanism of Gluconate 5-Dehydrogenase from Streptococcus Suis: Crystal Structures of the Substrate-Free and Quaternary Complex Enzymes.
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A S150 M151 P193 S147 M148 P190
BS02 NAP A G21 Y24 G25 I26 D45 I46 L50 D71 V72 N98 A99 G100 I148 Y163 K167 P193 G18 Y21 G22 I23 D42 I43 L47 D68 V69 N95 A96 G97 I145 Y160 K164 P190
BS03 GCO A I102 R104 S150 M152 R157 Y163 I99 R101 S147 M149 R154 Y160
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 13:31:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3o03', asym_id = 'A', title = 'Structural Insight Into the Catalytic Mechanism ...e Substrate-Free and Quaternary Complex Enzymes. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3o03', asym_id='A', title='Structural Insight Into the Catalytic Mechanism ...e Substrate-Free and Quaternary Complex Enzymes. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '3o03', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='3o03', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>