Structure of PDB 3nu3 Chain A |
>3nu3A (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
|
PDB | 3nu3 Amprenavir complexes with HIV-1 protease and its drug-resistant mutants altering hydrophobic clusters. |
Chain | A |
Resolution | 1.02 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
478 |
A |
D25 A28 D30 |
D25 A28 D30 |
PDBbind-CN: -logKd/Ki=9.82,Ki=0.15nM |
|
|
|