Structure of PDB 3np3 Chain A |
>3np3A (length=128) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFDTFPGHSALEKGTLTLK |
|
PDB | 3np3 Outer-Sphere Effects on Reduction Potentials of Copper Sites in Proteins: The Curious Case of High Potential Type 2 C112D/M121E Pseudomonas aeruginosa Azurin. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
G45 H46 D112 H117 |
G45 H46 D112 H117 |
|
|
|
|