Structure of PDB 3noy Chain A

Receptor sequence

>3noyA (length=349) Species: 63363 (Aquifex aeolicus)

MIQKRKTRQIRVGNVKIGGDAPIVVQSMTSTKTHDVEATLNQIKRLYEAG
CEIVRVAVPHKEDVEALEEIVKKSPMPVIADIHFAPSYAFLSMEKGVHGI
RINPGNIGKEEIVREIVEEAKRRGVAVRIGVNSGSLEKDLLEKYGYPSAE
ALAESALRWSEKFEKWGFTNYKVSIKGSDVLQNVRANLIFAERTDVPLHI
GITEAGMGTKGIIKSSVGIGILLYMGIGDTVRVSLTDDPVVEVETAYEIL
KSLGLRRRGVEIVACPTCGRIEVDLPKVVKEVQEKLSGVKTPLKVAVMGC
VVNAIGEAREADIGLACGRGFAWLFKHGKPIKKVDESEMVDELLKEIQN

3D structure

• PDB: 3noy Biosynthesis of isoprenoids: crystal structure of the [4Fe-4S] cluster protein IspG.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C265 P266 T267 C268 R270 I271 M298 G299 C300 A304 E307	C265 P266 T267 C268 R270 I271 M298 G299 C300 A304 E307

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0016491 oxidoreductase activity
• GO:0046429 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity (ferredoxin)
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding
• GO:0141197 4-hydroxy-3-methylbut-2-enyl-diphosphate synthase activity (flavodoxin)

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0016114 terpenoid biosynthetic process
• GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
• GO:0044237 cellular metabolic process

External links

• PDB: RCSB:3noy, PDBe:3noy, PDBj:3noy
• PDBsum: 3noy
• PubMed: 20932974
• UniProt: O67496|ISPG_AQUAE 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (Gene Name=ispG)