Structure of PDB 3nm7 Chain A

Receptor sequence

>3nm7A (length=84) Species: 139 (Borreliella burgdorferi)

ERGEVYSEKLFTESERTYFFNVKENRKGDYFLNIVESKRSPSGDFERHSI
FVYEENINEFESNLLKAIAVIKQKVSTGSSARHN

3D structure

• PDB: 3nm7 X-ray structure of Pur-alpha reveals a Whirly-like fold and an unusual nucleic-acid binding surface
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	T19 S21	T12 S14

Gene Ontology

Molecular Function

• GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0032422 purine-rich negative regulatory element binding

Biological Process

• GO:0006417 regulation of translation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3nm7, PDBe:3nm7, PDBj:3nm7
• PDBsum: 3nm7
• UniProt: O51076|BPUR_BORBU Transcriptional/translational repressor BpuR (Gene Name=bpuR)