Structure of PDB 3njl Chain A |
>3njlA (length=119) Species: 70863 (Shewanella oneidensis) [Search protein sequence] |
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQT LKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLS NTANTLLVLSPAPQIINRP |
|
PDB | 3njl Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase. |
Chain | A |
Resolution | 1.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
G71 D74 D91 T93 |
G67 D70 D87 T89 |
|
|
|
|