Structure of PDB 3n7s Chain A

Receptor sequence
>3n7sA (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
IQLGVTRNKIMTAQYECYQKIMQDPIEGVYCNRTWDGWLCWNDVAAGTES
MQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCN
3D structure
PDB3n7s Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 3N6 A I41 G71 W72 F92 D94 R119 W121 T122 Y124 I10 G37 W38 F58 D60 R85 W87 T88 Y90 MOAD: Kd<20nM
PDBbind-CN: -logKd/Ki=7.70,Kd=20nM
BindingDB: IC50=0.030000nM,Ki=0.010000nM,EC50=0.026000nM
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004948 calcitonin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3n7s, PDBe:3n7s, PDBj:3n7s
PDBsum3n7s
PubMed20826335
UniProtQ16602|CALRL_HUMAN Calcitonin gene-related peptide type 1 receptor (Gene Name=CALCRL)

[Back to BioLiP]