Structure of PDB 3n7e Chain A |
>3n7eA (length=59) Species: 266264 (Cupriavidus metallidurans CH34) [Search protein sequence] |
NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIM KGNEIFRLD |
|
PDB | 3n7e Two new crystal forms of copper resistance protein CopK |
Chain | A |
Resolution | 2.295 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H19 E29 |
H15 E25 |
|
|
|
|