Structure of PDB 3n5w Chain A

Receptor sequence

>3n5wA (length=407) Species: 10116 (Rattus norvegicus)

RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPTKDQLFPLAK
EFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAW
RNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAI
TIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQG
WKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGL
KWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEE
VAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFI
KHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPD
PWNTHVW

3D structure

• PDB: 3n5w Role of zinc in isoform-selective inhibitor binding to neuronal nitric oxide synthase .
• Chain: A
• Resolution: 1.73 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C415 R418 W587 E592
• Catalytic site (residue number reindexed from 1): C106 R109 W278 E283
• Enzyme Commision number: 1.14.13.39: nitric-oxide synthase (NADPH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	W409 C415 V416 M570 F584 W587 E592 R596 W678 F704	W100 C106 V107 M261 F275 W278 E283 R287 W369 F395
BS02	XFJ	A	M336 V567 F584 W587 E592 R596 Y706	M38 V258 F275 W278 E283 R287 Y397	MOAD: Ki=25nM BindingDB: Ki=25nM
BS03	XFJ	A	R596 D600 V677 W678	R287 D291 V368 W369	MOAD: Ki=25nM BindingDB: Ki=25nM
BS04	CL	A	R596 D600	R287 D291
BS05	ZN	A	C326 C331	C28 C33
BS06	XFJ	A	W306 F691 H692	W8 F382 H383	MOAD: Ki=25nM BindingDB: Ki=25nM

Gene Ontology

Molecular Function

• GO:0004517 nitric-oxide synthase activity

Biological Process

• GO:0006809 nitric oxide biosynthetic process

External links

• PDB: RCSB:3n5w, PDBe:3n5w, PDBj:3n5w
• PDBsum: 3n5w
• PubMed: 21138269
• UniProt: P29476|NOS1_RAT Nitric oxide synthase 1 (Gene Name=Nos1)