Structure of PDB 3mn7 Chain A

Receptor sequence

>3mn7A (length=359) Species: 7227 (Drosophila melanogaster)

VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPDSYVGDEAQSKRGILT
LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR
EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIY
EGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTEEREIVRDIKEKL
CYVALDFEQEMATAASSSSLEKSYELKDGQVITIGNERFRCPEALFQPSF
LGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE
ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG
PSIVHRKCF

3D structure

• PDB: 3mn7 Structures of actin-bound Wiskott-Aldrich syndrome protein homology 2 (WH2) domains of Spire and the implication for filament nucleation.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	G23 D25 Y143 T148 E167 Y169 S348 T351	G19 D21 Y127 T132 E151 Y153 S332 T335
BS02	ATP	A	G13 S14 G15 K18 G156 D157 G158 K213 E214 G301 G302 M305 Y306 K336	G9 S10 G11 K14 G140 D141 G142 K197 E198 G285 G286 M289 Y290 K320

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0000281 mitotic cytokinesis
• GO:0006338 chromatin remodeling
• GO:0007291 sperm individualization
• GO:0030723 ovarian fusome organization
• GO:0032507 maintenance of protein location in cell
• GO:0035148 tube formation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0031011 Ino80 complex
• GO:0035060 brahma complex

External links

• PDB: RCSB:3mn7, PDBe:3mn7, PDBj:3mn7
• PDBsum: 3mn7
• PubMed: 20538977
• UniProt: P10987|ACT1_DROME Actin-5C (Gene Name=Act5C)