Structure of PDB 3mm9 Chain A

Receptor sequence

>3mm9A (length=417) Species: 2234 (Archaeoglobus fulgidus)

SETPLLDELEKGPWPSFVKEIKKTAELMEKAAAEGKDVKMPKGARGLLKQ
LEISYKDKKTHWKHGGIVSVVGYGGGVIGRYSDLGEQIPEVEHFHTMRIN
QPSGWFYSTKALRGLCDVWEKWGSGLTNFHGSTGDIIFLGTRSEYLQPCF
EDLGNLEIPFDIGGSGSDLRTPSACMGPALCEFACYDTLELCYDLTMTYQ
DELHRPMWPYKFKIKCAGCPNDCVASKARSDFAIIGTWKDDIKVDQEAVK
EYASWMDIENEVVKLCPTGAIKWDGKELTIDNRECVRCMHCINKMPKALK
PGDERGATILIGGKAPFVEGAVIGWVAVPFVEVEKPYDEIKEILEAIWDW
WDEEGKFRERIGELIWRKGMREFLKVIGREADVRMVKAPRNNPFMFFEKD
ELKPSAYTEELKKRGMW

3D structure

• PDB: 3mm9 Reaction cycle of the dissimilatory sulfite reductase from Archaeoglobus fulgidus.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 1.8.1.22: dissimilatory sulfite reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SRM	A	R80 R98 G131 S132 T133 D135 I137 Y210 K211 K213 K215 R229 K314 A315 F317 R358 R360	R80 R98 G131 S132 T133 D135 I137 Y210 K211 K213 K215 R229 K314 A315 F317 R358 R360
BS02	SF4	A	C175 C181 A184 G218 C219 C223	C175 C181 A184 G218 C219 C223
BS03	SF4	A	C266 P267 C285 V286 R287 C288 M289 C291	C266 P267 C285 V286 R287 C288 M289 C291
BS04	NO2	A	R98 R170 K213	R98 R170 K213
BS05	SRM	A	C175 M176 C181 E182 F183 N221 C223 N293	C175 M176 C181 E182 F183 N221 C223 N293

Gene Ontology

Molecular Function

• GO:0016002 sulfite reductase activity
• GO:0016491 oxidoreductase activity
• GO:0018551 dissimilatory sulfite reductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0050311 sulfite reductase (ferredoxin) activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0000103 sulfate assimilation

Cellular Component

• GO:0009337 sulfite reductase complex (NADPH)
• GO:0016020 membrane

External links

• PDB: RCSB:3mm9, PDBe:3mm9, PDBj:3mm9
• PDBsum: 3mm9
• PubMed: 20822098
• UniProt: Q59109|DSRA_ARCFU Sulfite reductase, dissimilatory-type subunit alpha (Gene Name=dsrA)