Structure of PDB 3mln Chain A

Receptor sequence

>3mlnA (length=206) Species: 10090 (Mus musculus) [Search protein sequence]

GVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEI
ERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSM
TKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIID
RFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFV
HNNSKH

3D structure

PDB

3mln Structure of an Ebf1:DNA complex reveals unusual DNA recognition and structural homology with Rel proteins

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	R63 S65 N66 F67 H157 C161 S162 R163 N172 A202 G203 N204 S238 K239	R29 S31 N32 F33 H123 C127 S128 R129 N138 A168 G169 N170 S204 K205
BS02	dna	A	K64 S169 G171 N174 N197 L199 N201 A202 G203 P205 F233 H235 N236 N237	K30 S135 G137 N140 N163 L165 N167 A168 G169 P171 F199 H201 N202 N203
BS03	ZN	A	H157 C161 C164 C170	H123 C127 C130 C136

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3mln, PDBe:3mln, PDBj:3mln
PDBsum	3mln
PubMed	20876732
UniProt	Q07802\|COE1_MOUSE Transcription factor COE1 (Gene Name=Ebf1)

[Back to BioLiP]