Structure of PDB 3mdi Chain A

Receptor sequence
>3mdiA (length=199) Species: 9606 (Homo sapiens) [Search protein sequence]
KPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRR
TVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEI
LGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQ
LQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
3D structure
PDB3mdi Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing.
ChainA
Resolution2.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A E55 R63 L99 G100 T101 T102 F103 F104 K192 P206 G207 Y208 G209 E27 R35 L71 G72 T73 T74 F75 F76 K164 P178 G179 Y180 G181
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0035925 mRNA 3'-UTR AU-rich region binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0042826 histone deacetylase binding
Biological Process
GO:0006397 mRNA processing
GO:0010608 post-transcriptional regulation of gene expression
GO:0030154 cell differentiation
GO:0031124 mRNA 3'-end processing
GO:0051262 protein tetramerization
GO:0051290 protein heterotetramerization
GO:0110104 mRNA alternative polyadenylation
GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway
GO:2000738 positive regulation of stem cell differentiation
GO:2000975 positive regulation of pro-B cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0005849 mRNA cleavage factor complex
GO:0016604 nuclear body
GO:0034451 centriolar satellite
GO:0042382 paraspeckles

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mdi, PDBe:3mdi, PDBj:3mdi
PDBsum3mdi
PubMed20479262
UniProtO43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 (Gene Name=NUDT21)

[Back to BioLiP]