Structure of PDB 3m9e Chain A

Receptor sequence
>3m9eA (length=101) Species: 10116 (Rattus norvegicus) [Search protein sequence]
ELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIID
KVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREEL
Q
3D structure
PDB3m9e Structure of a thyroid hormone receptor DNA-binding domain homodimer bound to an inverted palindrome DNA response element.
ChainA
Resolution2.406 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y116 H117 Y118 R131 L177 V178 L179 R184 K187 R188 Y13 H14 Y15 R28 L74 V75 L76 R81 K84 R85 PDBbind-CN: Kd=0.13uM
BS02 dna A E124 R132 R157 N158 Q161 R164 L190 N194 R195 E21 R29 R54 N55 Q58 R61 L87 N91 R92 PDBbind-CN: Kd=0.13uM
BS03 ZN A C106 C109 C123 C126 C3 C6 C20 C23
BS04 ZN A C144 C150 C160 C163 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3m9e, PDBe:3m9e, PDBj:3m9e
PDBsum3m9e
PubMed20610536
UniProtP18113|THB_RAT Thyroid hormone receptor beta (Gene Name=Thrb)

[Back to BioLiP]