Structure of PDB 3m57 Chain A

Receptor sequence

>3m57A (length=244) Species: 9606 (Homo sapiens)

HGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMI
EGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDPYESER
VYVAESLISSAGEGLFSKVAVGPNTVMSFANGVRITHQEVDSRDWALNGN
TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGP
IKCIRTLRAVEADEELTVAYGYDHSPPEAPEWYQVELKAFQATQ

3D structure

• PDB: 3m57 SET7/9 catalytic mutants reveal the role of active site water molecules in lysine multiple methylation.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A245 H293 H297 Y305 Y335
• Catalytic site (residue number reindexed from 1): A130 H178 H182 Y190 Y220
• Enzyme Commision number: 2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V255 D256 R258 W260 N263 G264 T266 L267 S268 E271 Y305 K317 Y335 Y337 D338 E348	V140 D141 R143 W145 N148 G149 T151 L152 S153 E156 Y190 K202 Y220 Y222 D223 E228
BS02	SAH	A	A226 E228 G264 H293 K294 N296 H297 Y335 W352 E356	A111 E113 G149 H178 K179 N181 H182 Y220 W232 E236

Gene Ontology

Molecular Function

• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0140945 histone H3K4 monomethyltransferase activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005694 chromosome

External links

• PDB: RCSB:3m57, PDBe:3m57, PDBj:3m57
• PDBsum: 3m57
• PubMed: 20675860
• UniProt: Q8WTS6|SETD7_HUMAN Histone-lysine N-methyltransferase SETD7 (Gene Name=SETD7)