Structure of PDB 3m1i Chain A

Receptor sequence

>3m1iA (length=200) Species: 4932 (Saccharomyces cerevisiae)

VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG
EIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRD
LVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNF
EKPFLWLARKLAGNPQLEFVASPALAPPEQQYQQEMEQATALPLPDEDDA

3D structure

• PDB: 3m1i An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G21 G22 T23 G24 K25 T26 T27 E38 K39 Y41 A43 T44 G70 N124 K125 D127 S152 A153 K154	G12 G13 T14 G15 K16 T17 T18 E29 K30 Y32 A34 T35 G61 N115 K116 D118 S143 A144 K145
BS02	MG	A	T26 T44	T17 T35

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0000054 ribosomal subunit export from nucleus
• GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006606 protein import into nucleus
• GO:0006913 nucleocytoplasmic transport
• GO:0006997 nucleus organization
• GO:0015031 protein transport
• GO:0016973 poly(A)+ mRNA export from nucleus
• GO:0046822 regulation of nucleocytoplasmic transport
• GO:1901987 regulation of cell cycle phase transition

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3m1i, PDBe:3m1i, PDBj:3m1i
• PDBsum: 3m1i
• PubMed: 20485264
• UniProt: P32835|GSP1_YEAST GTP-binding nuclear protein GSP1/CNR1 (Gene Name=GSP1)