Structure of PDB 3lzw Chain A

Receptor sequence

>3lzwA (length=329) Species: 1423 (Bacillus subtilis)

MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALY
PEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGV
FKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQ
KFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLH
ASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVS
SLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGF
GEAPTAVNNAKAYMDPKARVQPLHSTSLF

3D structure

• PDB: 3lzw Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D147 D148
• Catalytic site (residue number reindexed from 1): D147 D148
• Enzyme Commision number: 1.18.1.2: ferredoxin--NADP(+) reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	I13 G14 G16 P17 V18 E37 S38 G44 Q45 L46 Y50 I55 D57 A89 V90 A119 G120 G122 A123 F124 G284 D285 L295 I296	I13 G14 G16 P17 V18 E37 S38 G44 Q45 L46 Y50 I55 D57 A89 V90 A119 G120 G122 A123 F124 G284 D285 L295 I296
BS02	NAP	A	A48 L49 E52 G162 G163 D164 S165 D168 H184 R185 R186 R190 H192 Y246 G247	A48 L49 E52 G162 G163 D164 S165 D168 H184 R185 R186 R190 H192 Y246 G247	MOAD: Kd=14uM

Gene Ontology

Molecular Function

• GO:0004324 ferredoxin-NADP+ reductase activity
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050661 NADP binding

Biological Process

• GO:0045454 cell redox homeostasis
• GO:0098869 cellular oxidant detoxification

External links

• PDB: RCSB:3lzw, PDBe:3lzw, PDBj:3lzw
• PDBsum: 3lzw
• PubMed: 20878669
• UniProt: O05268|FENR2_BACSU Ferredoxin--NADP reductase 2 (Gene Name=yumC)