Structure of PDB 3lq3 Chain A

Receptor sequence

>3lq3A (length=339) Species: 9606 (Homo sapiens)

SRDAERRAYQWCREYLGGAWRRVQPEELRVYPVNLLFRCSLPDHLPSVGE
EPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQ
YIPSRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYL
KQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEG
NILLLSEPDSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKAR
PTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALAS
HFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL

3D structure

• PDB: 3lq3 Crystal structures of human choline kinase isoforms in complex with hemicholinium-3: single amino acid near the active site influences inhibitor sensitivity.
• Chain: A
• Resolution: 1.42 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.32: choline kinase.
  2.7.1.82: ethanolamine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HC7	A	D242 Y267 E283 Y288 F295 W353 W356 E367 F368 Y370 Y373	D196 Y218 E234 Y239 F246 W304 W307 E318 F319 Y321 Y324
BS02	MG	A	N247 D264	N201 D215
BS03	ADP	A	L82 L102 R104 P133 Q146 Y147 I148 G246 D264	L36 L56 R58 P87 Q100 Y101 I102 G200 D215
BS04	AMP	A	L82 L102 Y147 I148 L249	L36 L56 Y101 I102 L203

Gene Ontology

Molecular Function

• GO:0004103 choline kinase activity
• GO:0004305 ethanolamine kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity

Biological Process

• GO:0006646 phosphatidylethanolamine biosynthetic process
• GO:0006656 phosphatidylcholine biosynthetic process
• GO:0006657 CDP-choline pathway
• GO:0007517 muscle organ development
• GO:0008654 phospholipid biosynthetic process
• GO:0016310 phosphorylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3lq3, PDBe:3lq3, PDBj:3lq3
• PDBsum: 3lq3
• PubMed: 20299452
• UniProt: Q9Y259|CHKB_HUMAN Choline/ethanolamine kinase (Gene Name=CHKB)