Structure of PDB 3ljz Chain A

Receptor sequence
>3ljzA (length=161) Species: 9606 (Homo sapiens) [Search protein sequence]
ANVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNF
TRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDD
DETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTHFMLPD
DDVQGIQSLYG
3D structure
PDB3ljz Structure analysis reveals the flexibility of the ADAMTS-5 active site.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H222 E223 H226 H232
Catalytic site (residue number reindexed from 1) H119 E120 H123 H129
Enzyme Commision number 3.4.24.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D162 N194 D198 D59 N91 D95
BS02 CA A D179 G180 S182 L184 D202 E205 D76 G77 S79 L81 D99 E102
BS03 ZN A H172 D174 H187 H200 H69 D71 H84 H97
BS04 ZN A H222 H226 H232 H119 H123 H129
BS05 LA3 A L185 A186 L218 H222 E223 H226 H232 L239 P242 I243 Y244 L82 A83 L115 H119 E120 H123 H129 L136 P139 I140 Y141 MOAD: Ki=7.3nM
PDBbind-CN: -logKd/Ki=8.14,Ki=7.3nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ljz, PDBe:3ljz, PDBj:3ljz
PDBsum3ljz
PubMed21370305
UniProtP45452|MMP13_HUMAN Collagenase 3 (Gene Name=MMP13)

[Back to BioLiP]