Structure of PDB 3lin Chain A |
>3linA (length=116) Species: 11908 (Human T-cell leukemia virus type I) [Search protein sequence] |
PVIPLDPARRPVIKAQVDTQTSHPKTIEALLDTGADMTVIPIALFSSNTP LKNTSVLGAGGQTQDHFKLTSLPVLIRLPFRTTPIVLTSCLVDTKNNWAI IGRDALQQCQGVLYLP |
|
PDB | 3lin Crystal structures of inhibitor complexes of human T-cell leukemia virus (HTLV-1) protease. |
Chain | A |
Resolution | 1.96 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
E13 |
A |
R10 D32 G34 W98 |
R10 D32 G34 W98 |
BindingDB: IC50=7.2nM |
|
|
|