Structure of PDB 3lik Chain A

Receptor sequence
>3likA (length=159) Species: 9606 (Homo sapiens) [Search protein sequence]
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINT
GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWT
THSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADD
IRGIQSLYG
3D structure
PDB3lik Insights from selective non-phosphinic inhibitors of MMP-12 tailored to fit with an S1' loop canonical conformation.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H218 E219 H222 H228
Catalytic site (residue number reindexed from 1) H114 E115 H118 H124
Enzyme Commision number 3.4.24.65: macrophage elastase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN A H218 H222 H228 H114 H118 H124
BS02 ZN A H168 D170 H183 H196 H64 D66 H79 H92
BS03 CA A D158 G190 G192 D194 D54 G86 G88 D90
BS04 CA A D124 E199 E201 D20 E95 E97
BS05 CA A D175 G176 G178 I180 D198 E201 D71 G72 G74 I76 D94 E97
BS06 EEG A G178 G179 L181 T215 H218 K233 A234 V235 P238 T239 Y240 K241 G74 G75 L77 T111 H114 K129 A130 V131 P134 T135 Y136 K137 MOAD: Ki=1.92nM
PDBbind-CN: -logKd/Ki=8.72,Ki=1.92nM
BindingDB: Ki=1.92nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3lik, PDBe:3lik, PDBj:3lik
PDBsum3lik
PubMed20817735
UniProtP39900|MMP12_HUMAN Macrophage metalloelastase (Gene Name=MMP12)

[Back to BioLiP]