Structure of PDB 3lh0 Chain A |
>3lh0A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] |
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDIL LCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKR MAVILSLEQGNRLREQYGLG |
|
PDB | 3lh0 Structural insight into p53 recognition by the 53BP1 tandem Tudor domain. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
Y1502 D1521 Y1523 |
Y19 D38 Y40 |
|
|
|