Structure of PDB 3lgh Chain A

Receptor sequence
>3lghA (length=131) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence]
IIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNP
ESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETI
ILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
3D structure
PDB3lgh Holo-Ni(II)HpNikR Is an Asymmetric Tetramer Containing Two Different Nickel-Binding Sites.
ChainA
Resolution2.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NI A H99 H101 C107 H88 H90 C96
BS02 MG A D73 H75 H105 D62 H64 H94
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016151 nickel cation binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010045 response to nickel cation
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lgh, PDBe:3lgh, PDBj:3lgh
PDBsum3lgh
PubMed20863122
UniProtO25896|NIKR_HELPY Putative nickel-responsive regulator (Gene Name=HP_1338)

[Back to BioLiP]