Structure of PDB 3leo Chain A

Receptor sequence

>3leoA (length=150) Species: 9606 (Homo sapiens)

HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARQAFRVSPPLTTGPPE
FERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQ
GYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT

3D structure

• PDB: 3leo Arginine 104 is a key catalytic residue in leukotriene C4 synthase.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.-
  4.4.1.20: leukotriene-C4 synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	R51 N55 E58 Y59 Y93 Y97 R104 L108	R56 N60 E63 Y64 Y98 Y102 R109 L113

Gene Ontology

Molecular Function

• GO:0004364 glutathione transferase activity
• GO:0004464 leukotriene-C4 synthase activity
• GO:0004602 glutathione peroxidase activity
• GO:0005515 protein binding
• GO:0008047 enzyme activator activity
• GO:0008289 lipid binding
• GO:0016740 transferase activity
• GO:0016829 lyase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006629 lipid metabolic process
• GO:0006691 leukotriene metabolic process
• GO:0019370 leukotriene biosynthetic process
• GO:0042759 long-chain fatty acid biosynthetic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005634 nucleus
• GO:0005635 nuclear envelope
• GO:0005640 nuclear outer membrane
• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0016020 membrane
• GO:0031965 nuclear membrane
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:3leo, PDBe:3leo, PDBj:3leo
• PDBsum: 3leo
• PubMed: 20980252
• UniProt: Q16873|LTC4S_HUMAN Leukotriene C4 synthase (Gene Name=LTC4S)