Structure of PDB 3ldy Chain A

Receptor sequence

>3ldyA (length=142) Species: 43263 (Pseudomonas alcaligenes) [Search protein sequence]

MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKAT
FLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGY
SPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA

3D structure

PDB

3ldy Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.

Chain

Resolution

1.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	R6 Y35 K39 P81 R82 R114	R6 Y35 K39 P81 R82 R114
BS02	dna	A	Y17 G19 S20 S21 M28 N32 N36 K39 E40 N80 P81 Y84 H85 I86 Q87 C88 G90 V91 D92 R93 F110 R114 S117 N118	Y17 G19 S20 S21 M28 N32 N36 K39 E40 N80 P81 Y84 H85 I86 Q87 C88 G90 V91 D92 R93 F110 R114 S117 N118
BS03	ZN	A	C63 C66 C109 C112	C63 C66 C109 C112
BS04	ZN	A	C4 C7 C24 C27	C4 C7 C24 C27
BS05	CA	A	D92 N113	D92 N113

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

External links