Structure of PDB 3lag Chain A |
>3lagA (length=96) Species: 258594 (Rhodopseudomonas palustris CGA009) [Search protein sequence] |
GMTVAAKSEIQIDNDEVRVTEWRLPPGSATGHHTHGMDYVVVPMADGEMT IVAPDGTRSLAQLKTGRSYARKAGVQHDVRNESTAEIVFLEIELKA |
|
PDB | 3lag The crystal structure of a functionally unknown protein RPA4178 from Rhodopseudomonas palustris CGA009 |
Chain | A |
Resolution | 1.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D14 E15 |
D15 E16 |
|
|
|
|