Structure of PDB 3l8g Chain A

Receptor sequence

>3l8gA (length=183) Species: 83333 (Escherichia coli K-12)

SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVT
NQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEF
RQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKV
LVRTGKPITPEAENAADWVLNSLADLPQAIKKQ

3D structure

• PDB: 3l8g Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
• Chain: A
• Resolution: 2.18 Å

Enzymatic activity

• Enzyme Commision number: 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D11 D13 D136	D8 D10 D133
BS02	ZN	A	C92 H94 C107 C109	C89 H91 C104 C106
BS03	GMB	A	D11 R12 D13 D19 G21 Y22 T53 N54 S56 R110 K111	D8 R9 D10 D16 G18 Y19 T50 N51 S53 R107 K108

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016791 phosphatase activity
• GO:0034200 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0009103 lipopolysaccharide biosynthetic process
• GO:0009244 lipopolysaccharide core region biosynthetic process
• GO:0097171 ADP-L-glycero-beta-D-manno-heptose biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3l8g, PDBe:3l8g, PDBj:3l8g
• PDBsum: 3l8g
• PubMed: 20050614
• UniProt: P63228|GMHBB_ECOLI D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (Gene Name=gmhB)