Structure of PDB 3l4o Chain A

Receptor sequence

>3l4oA (length=353) Species: 318586 (Paracoccus denitrificans PD1222)

DDALAALGAQLFVDPALSRNATQSCATCHDPARAFTDPREGKAGLAVSVG
DDGQSHGDRNTPTLGYAALVPAFHRDANGKYKGGQFWDGRADDLKQQAGQ
PMLNPVEMAMPDRAAVAARLRDDPAYRTGFEALFGKGVLDDPERAFDAAA
EALAAYQATGEFSPFDSKYDRVMRGEEKFTPLEEFGYTVFITWNCRLCHM
QRKQGVAERETFTNFEYHNIGLPVNETAREASGLGADHVDHGLLARPGIE
DPAQSGRFKVPSLRNVAVTGPYMHNGVFTDLRTAILFYNKYTSRRPEAKI
NPETGAPWGEPEVARNLSLAELQSGLMLDDGRVDALVAFLETLTDRRYEP
LLE

3D structure

• PDB: 3l4o In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
• Chain: A
• Resolution: 2.046 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E113
• Catalytic site (residue number reindexed from 1): E107
• Enzyme Commision number: 1.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	N66 T275 P277	N60 T269 P271
BS02	HEC	A	Q29 C31 C34 H35 R65 T67 P68 L70 Q91 F92 W93 R96 Q103 P107 M114 K265	Q23 C25 C28 H29 R59 T61 P62 L64 Q85 F86 W87 R90 Q97 P101 M108 K259
BS03	HEC	A	N200 C201 C204 H205 H224 L228 F264 V266 P267 Y278 M279 H280 Y294	N194 C195 C198 H199 H218 L222 F258 V260 P261 Y272 M273 H274 Y288

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3l4o, PDBe:3l4o, PDBj:3l4o
• PDBsum: 3l4o
• PubMed: 20223990
• UniProt: Q51658|MAUG_PARDP Methylamine utilization protein MauG (Gene Name=mauG)