Structure of PDB 3l2c Chain A

Receptor sequence
>3l2cA (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNS
SAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLN
3D structure
PDB3l2c Structure of the human FOXO4-DBD-DNA complex at 1.9 A resolution reveals new details of FOXO binding to the DNA
ChainA
Resolution1.868 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R94 N95 S101 Y102 N148 H152 R2 N3 S9 Y10 N56 H60 PDBbind-CN: Kd=360nM
BS02 dna A L120 N141 S142 R151 H152 S155 K162 S171 S172 W174 L28 N49 S50 R59 H60 S63 K70 S79 S80 W82 PDBbind-CN: Kd=360nM
BS03 MG A L154 S155 H157 F160 L62 S63 H65 F68
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3l2c, PDBe:3l2c, PDBj:3l2c
PDBsum3l2c
PubMed21123876
UniProtP98177|FOXO4_HUMAN Forkhead box protein O4 (Gene Name=FOXO4)

[Back to BioLiP]