Structure of PDB 3l1p Chain A

Receptor sequence
>3l1pA (length=147) Species: 10090 (Mus musculus) [Search protein sequence]
DMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRF
EALQLSLKNMSKLRPLLEKWVEEADNNENLQEISKSVQARKRKRTSIENR
VRWSLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGKR
3D structure
PDB3l1p A unique Oct4 interface is crucial for reprogramming to pluripotency
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F42 S43 T45 T46 R49 S56 N59 R97 K117 R145 Q146 F42 S43 T45 T46 R49 S56 N59 R94 K114 R142 Q143
BS02 dna A R20 T26 Q27 Q44 T45 R49 R97 T98 I100 V139 N143 R20 T26 Q27 Q44 T45 R49 R94 T95 I97 V136 N140
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3l1p, PDBe:3l1p, PDBj:3l1p
PDBsum3l1p
PubMed23376973
UniProtP20263|PO5F1_MOUSE POU domain, class 5, transcription factor 1 (Gene Name=Pou5f1)

[Back to BioLiP]