Structure of PDB 3l1e Chain A |
>3l1eA (length=105) Species: 9913 (Bos taurus) [Search protein sequence] |
SGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHG YISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKIPSGVDAGHSERA IPVSR |
|
PDB | 3l1e Crystal structures of truncated alphaA and alphaB crystallins reveal structural mechanisms of polydispersity important for eye lens function. |
Chain | A |
Resolution | 1.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H100 E102 |
H42 E44 |
|
|
|