Structure of PDB 3l0p Chain A

Receptor sequence

>3l0pA (length=222) Species: 879 (Megalodesulfovibrio gigas)

MNILIFGPNGSGKGTQGNLVKDKYSLAHIESGGIFREHIGGGTELGKKAK
EFIDRGDLVPDDITIPMVLETLESKGKDGWLLDGFPRNTVQAQKLFEALQ
EKGMKINFVIEILLPREVAKNRIMGRRICKNNPNHPNNIFIEAIKPNGDV
CRVCGGALSARADDQDEGAINKRHDIYYNTVDGTLAAAYYYKNMAAKEGF
VYIELDGESIDSIKDTLLAQLA

3D structure

• PDB: 3l0p Crystal structure of the zinc-, cobalt-, and iron-containing adenylate kinase from Desulfovibrio gigas: a novel metal-containing adenylate kinase from Gram-negative bacteria
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K13 R87 R126 R161 R173
• Catalytic site (residue number reindexed from 1): K13 R87 R126 R161 R173
• Enzyme Commision number: 2.7.4.3: adenylate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	A	C129 H135 C151 C154	C129 H135 C151 C154

Gene Ontology

Molecular Function

• GO:0004017 adenylate kinase activity
• GO:0004550 nucleoside diphosphate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0019205 nucleobase-containing compound kinase activity
• GO:0046872 metal ion binding
• GO:0050145 nucleoside monophosphate kinase activity

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0009123 nucleoside monophosphate metabolic process
• GO:0009132 nucleoside diphosphate metabolic process
• GO:0009165 nucleotide biosynthetic process
• GO:0016310 phosphorylation
• GO:0044209 AMP salvage
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3l0p, PDBe:3l0p, PDBj:3l0p
• PDBsum: 3l0p
• PubMed: 20821240
• UniProt: C7U112