Structure of PDB 3kzk Chain A

Receptor sequence

>3kzkA (length=334) Species: 190485 (Xanthomonas campestris pv. campestris str. ATCC 33913)

LKHFLNTQDWSRAELDALLTQAALFKRNKLGSELKGKSIALVFFNPSMRT
RTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVL
GRYVDLIGVRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPCQE
LAHALALQEHFGTPDLRGKKYVLTWTYHPKPLNTAVANSALTIATRMGMD
VTLLCPTPDYILDERYMDWAAQNVAESGGSLQVSHDIDSAYAGADVVYAK
SWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGVFSHCLPLRRNVK
ATDAVMDSPNCIAIDEAENRLHVQKAIMAALVGQ

3D structure

• PDB: 3kzk Crystal structure of N-acetylornithine transcarbamylase from Xanthomonas campestris: a novel enzyme in a new arginine biosynthetic pathway found in several eubacteria.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R112 H148 Q151 K252 C294 R322
• Catalytic site (residue number reindexed from 1): R110 H146 Q149 K250 C292 R320
• Enzyme Commision number: 2.1.3.9: N-acetylornithine carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OLN	A	R112 E144 H148 Q151 K252 C294 L295 R322	R110 E142 H146 Q149 K250 C292 L293 R320

Gene Ontology

Molecular Function

• GO:0004585 ornithine carbamoyltransferase activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity
• GO:0043857 N-acetylornithine carbamoyltransferase activity

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0006526 L-arginine biosynthetic process
• GO:0019240 citrulline biosynthetic process
• GO:0042450 arginine biosynthetic process via ornithine

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3kzk, PDBe:3kzk, PDBj:3kzk
• PDBsum: 3kzk
• PubMed: 15731101
• UniProt: Q8P8J2|AOTC_XANCP N-acetylornithine carbamoyltransferase (Gene Name=argF')