Structure of PDB 3kze Chain A |
>3kzeA (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] |
AMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKK GLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL |
|
PDB | 3kze The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
E849 K850 P918 |
E12 K13 P81 |
|
|
|
|