Structure of PDB 3kyw Chain A |
>3kywA (length=54) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] |
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE KLED |
|
PDB | 3kyw Unambiguous determination of H-atom positions: comparing results from neutron and high-resolution X-ray crystallography. |
Chain | A |
Resolution | 1.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
C5 C8 C38 C41 |
C6 C9 C39 C42 |
|
|
|
|