Structure of PDB 3kyu Chain A

Receptor sequence

>3kyuA (length=54) Species: 2261 (Pyrococcus furiosus)

MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE
KLED

3D structure

• PDB: 3kyu Unambiguous determination of H-atom positions: comparing results from neutron and high-resolution X-ray crystallography.
• Chain: A
• Resolution: 1.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	A	C5 C8 C38 C41	C6 C9 C39 C42

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding

Biological Process

• GO:0043448 alkane catabolic process

External links

• PDB: RCSB:3kyu, PDBe:3kyu, PDBj:3kyu
• PDBsum: 3kyu
• PubMed: 20445231
• UniProt: P24297|RUBR_PYRFU Rubredoxin (Gene Name=rub)