Structure of PDB 3kyq Chain A

Receptor sequence
>3kyqA (length=193) Species: 10116 (Rattus norvegicus) [Search protein sequence]
LMKLYSLSVFYKGEPKAVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVE
RSAKGSRASVKEQEYLCHVYVRSDSLAGVVIADSEYPSRVAFTLLEKVLD
EFSKQVDRIDWPVGSPATIHYTALDGHLSRYQNPREADPMSKVQAELDET
KIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQN
3D structure
PDB3kyq Lipid-Induced Conformational Switch Controls Fusion Activity of Longin Domain SNARE Ykt6
ChainA
Resolution2.443 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DPV A S27 F28 Q32 T43 Y64 S28 F29 Q33 T44 Y65 MOAD: Kd=61uM
PDBbind-CN: -logKd/Ki=4.22,Kd=60uM
Gene Ontology
Molecular Function
GO:0005484 SNAP receptor activity
GO:0016740 transferase activity
GO:0019706 protein-cysteine S-palmitoyltransferase activity
Biological Process
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006903 vesicle targeting
GO:0006904 vesicle docking involved in exocytosis
GO:0008150 biological_process
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0042147 retrograde transport, endosome to Golgi
GO:0061025 membrane fusion
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031201 SNARE complex
GO:0031410 cytoplasmic vesicle
GO:0043025 neuronal cell body
GO:0097440 apical dendrite
GO:0097441 basal dendrite

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kyq, PDBe:3kyq, PDBj:3kyq
PDBsum3kyq
PubMed20159557
UniProtQ5EGY4|YKT6_RAT Synaptobrevin homolog YKT6 (Gene Name=Ykt6)

[Back to BioLiP]