Structure of PDB 3kxb Chain A

Receptor sequence
>3kxbA (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence]
RPGTVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMA
LQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB3kxb Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R42 R63 R72 R83 F84 S86 R116 V117 T118 R1 R22 R31 R42 F43 S45 R75 V76 T77
BS02 dna A R42 P43 V46 R49 R63 L65 P66 R69 R1 P2 V5 R8 R22 L24 P25 R28
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3kxb, PDBe:3kxb, PDBj:3kxb
PDBsum3kxb
PubMed20100606
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]